PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00140.1.g00030.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 341aa    MW: 37497.8 Da    PI: 4.829
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00140.1.g00030.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.41.1e-31140196258
                                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                                   +Dgy+WrKYGqK++k+s++prsYYrCt ++C++kk+ver+++dp+++ +tYeg H h
  Zpz_sc00140.1.g00030.1.am.mk 140 EDGYKWRKYGQKSIKNSPNPRSYYRCTNPRCNAKKQVERATDDPDTLLVTYEGLHLH 196
                                   8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081127.301134199IPR003657WRKY domain
SuperFamilySSF1182901.7E-26135197IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.3E-29135197IPR003657WRKY domain
SMARTSM007744.0E-36139198IPR003657WRKY domain
PfamPF031062.5E-25140196IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MEELDALESS KRYWQQQDDL LGEEELMTMG GELLDERTPP PTVYSPAGYS NKHQVVVDEK  60
QEGPRRRRES MVNKLISTVY SGPTISDIES ALSFTGGGDG QQLAVKYNSS PVVFSPEKVL  120
NKMENKYTLK IKMCGSGLAE DGYKWRKYGQ KSIKNSPNPR SYYRCTNPRC NAKKQVERAT  180
DDPDTLLVTY EGLHLHYTYS HFLHGTQAQQ QQGLPKKPKK GPPNTSMLLS DHGEILDINS  240
TTPGGAGDAA VPDVPVIEEA AAAAASWGYF DGGAEEQQQQ HMEDDMASDG GLLEDVVPLL  300
VRRPCGSTTS STSNDNSPPS PVSWTTPTSP YIDMAILSNI F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-201381961674Probable WRKY transcription factor 4
2lex_A3e-201381961674Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001130113.16e-96putative WRKY DNA-binding domain superfamily protein
TrEMBLB4F8027e-96B4F802_MAIZE; Uncharacterized protein
STRINGAC165171.2_FGP0022e-95(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75253551
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.12e-43WRKY DNA-binding protein 49